PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00944.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 448aa    MW: 49681.8 Da    PI: 6.3634
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00944.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.82.6e-09301358562
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +   l+  +  l+++
  Rsa1.0_00944.1_g00013.1 301 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQFTLLQRDMMVLTNQ 358
                              899***************************************9998888777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-17297361IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553299362IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11301358No hitNo description
PfamPF001703.5E-8301351IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-11301358No hitNo description
CDDcd147032.06E-22302351No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGDTDTDMIH TSIPKQPHQL ELNPNHIHFS SDSTRRVGVP PTSPYSQIPT TRPQQPQGAT  60
HSRSRSRSMS QPSSFFSFDS LPPLSPSPFS FNNNNTSSPL LLPPSSPFTR CNSDSSSSRA  120
VLPPRKSHRR SNSDIHIPTC FNSPIPPFVK REDMDDDLFS AYMNLENIDA LNSSEADDDN  180
NDNSKNGESS RASGTTKTSD DTEEGESSSV NYESDRNNTL KRRADGGGGG GGGGGDVAPT  240
TRHYRSVSVD SCFMEKLSFG EEVSPTNSVS IEFKKGEFTA AEMKKIMAND KLAEMAMSDP  300
KRVKRILANR QSAARSKERK MRYIVELEHK VQTLQTEATT LSAQFTLLQR DMMVLTNQNN  360
ELKFRLQAME QQAQLRDALN EALSGEVQRL KLAIGETSHN EADRSKMQSL NADMFQQLNI  420
SQLTQQPQPQ SQQNQNGTMS PKPESNEL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808391e-148AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504351e-148AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109520.10.0PREDICTED: transcription factor VIP1-like
RefseqXP_009109519.10.0PREDICTED: transcription factor VIP1-like
RefseqXP_009109518.10.0PREDICTED: transcription factor VIP1-like
RefseqXP_009109517.10.0PREDICTED: transcription factor VIP1-like
TrEMBLM4D2L90.0M4D2L9_BRARP; Uncharacterized protein
STRINGBra010722.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-129bZIP family protein